PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.71CS3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family NAC
Protein Properties Length: 367aa    MW: 40432.3 Da    PI: 4.488
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.71CS3genomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1553.3e-4881333128
          NAM   3 pGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkge 98 
                  pG+rFhPtd elv+++Lk+kv gk++++ +vi+e+diyk+ PwdLp +  +k+++ ewyfF++r kky++g r nrat+ gyWk+tgkd++v + k+ 
  Araip.71CS3   8 PGYRFHPTDVELVQYFLKRKVMGKRFPC-DVIAELDIYKYPPWDLPdHsLLKTGDLEWYFFCPRGKKYSSGGRMNRATECGYWKTTGKDRSVEN-KKL 103
                  9***************************.99**************96346777888*************************************9.999 PP

          NAM  99 lvglkktLvfykgrapkgektdWvmheyrl 128
                  +vg+ ktLvf++g+apkg +tdWv+heyrl
  Araip.71CS3 104 VVGMIKTLVFHNGKAPKGDRTDWVLHEYRL 133
                  9***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.03E-585156IPR003441NAC domain
PROSITE profilePS5100553.8236156IPR003441NAC domain
PfamPF023658.9E-268133IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 367 aa     Download sequence    Send to blast
MAAMKSIPGY RFHPTDVELV QYFLKRKVMG KRFPCDVIAE LDIYKYPPWD LPDHSLLKTG  60
DLEWYFFCPR GKKYSSGGRM NRATECGYWK TTGKDRSVEN KKLVVGMIKT LVFHNGKAPK  120
GDRTDWVLHE YRLQDKDLAD KGVQQDSYVI CKVFQKDGPG PRNGAQYGRP FNEEDWDKED  180
EIDCVESAPV AALPAAVPIQ PASCHSSVVN NVNLSVSECY GLTSVSCLTG PMPSCSAHPS  240
APSNQVDGDI TPVPGSAIED NIMAPTENTT TEKVDNPPDI NNAEGTPCFD PNEIFGGLGD  300
LDGLFEMGGI GHGFSCGQNG GYTVNEMLSA SDGLRFPDPL DYLELGDLDT PLLWETNEQG  360
NWSQDNK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A8e-47215611168Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016180819.10.0PREDICTED: NAC domain-containing protein 82-like
TrEMBLG7JBJ41e-154G7JBJ4_MEDTR; NAC domain class transcription factor
STRINGGLYMA06G15840.11e-124(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF33023465
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G09330.41e-87NAC domain containing protein 82